haha1314.com - Collection of the funny, awesome, humor,crazy pics on the internet!

1.90 Rating by ClearWebStats
haha1314.com is 1 decade 4 months 6 days old. This website has a #1,654,774 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. While no active threats were reported recently by users, haha1314.com is SAFE to browse.
Get Custom Widget

Traffic Report of Haha1314

Daily Unique Visitors: 291
Daily Pageviews: 582

Estimated Valuation

Income Per Day: $ 2.00
Estimated Worth: $ 480.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: 2

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 1,654,774
Domain Authority: 14 ON 100 Click to see haha1314.com data on Moz
Google Pagerank
PR 0 out of 10
PageSpeed Score
84
Siteadvisor Rating
View haha1314.com site advisor rating No Risk Issues

Where is haha1314.com server located?

Hosted IP Address:

69.85.85.37 View other site hosted with haha1314.com

Hosted Country:

haha1314.com hosted country US haha1314.com hosted country

Location Latitude:

34.9273

Location Longitude:

-81.0222

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): 18
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View haha1314.com HTML resources

Homepage Links Analysis

HaHa1314 - Happiness & Funniest & Entertainment

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 10
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 35
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 69.85.85.37)

HaHa1314 - Happiness & Funniest & Entertainment

haha1314.com favicon - jhp8.com

haha1314.com - Collection of the funny, awesome, humor,crazy pics on the internet!

View haha1314.com Pagerank   haha1314.com alexa rank Not Applicable   haha1314.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Wed, 21 May 2014 14:27:18 GMT
Content-Type: text/html
Last-Modified: Wed, 21 May 2014 12:13:04 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Content-Encoding: gzip

Domain Information for haha1314.com

Domain Registrar: GODADDY.COM, LLC haha1314.com registrar info
Registration Date: 2014-01-03 1 decade 4 months 6 days ago
Last Modified: 2014-01-03 1 decade 4 months 6 days ago
Expiration Date: 2015-01-03 9 years 4 months 5 days ago

Domain Nameserver Information

Host IP Address Country
f1g1ns1.dnspod.net haha1314.com name server information 163.177.5.23 haha1314.com server is located in China China
f1g1ns2.dnspod.net haha1314.com name server information 129.211.176.239 haha1314.com server is located in China China

DNS Record Analysis

Host Type TTL Extra
haha1314.com A 600 IP:69.85.85.37
haha1314.com NS 600 Target:f1g1ns1.dnspod.net
haha1314.com NS 600 Target:f1g1ns2.dnspod.net
haha1314.com SOA 600 MNAME:f1g1ns1.dnspod.net
RNAME:freednsadmin.dnspod.com
Serial:1399452929
Refresh:3600
Retry:180
Expire:1209600

Similarly Ranked Websites to Haha1314

NpiCom

haha1314.com favicon - npicom.com

News Portal of Indonesian Community

View haha1314.com Pagerank   Alexa rank for haha1314.com 1,654,778   website value of haha1314.com $ 480.00

Modern Family Sweepstakes

haha1314.com favicon - modernfamilynightlysweepstakes.com

Win an Awesome TV and Home Theater System courtesy of Modern Family Nightly!

View haha1314.com Pagerank   Alexa rank for haha1314.com 1,654,779   website value of haha1314.com $ 480.00

Internetagentur Comwrap - Agentur für digitale Medien

haha1314.com favicon - comwrap.com

Als Internetagentur entwickelt comwrap Online-Shops, Websites und Communities, Kampagnen für Internet und Mobile. Internetagentur Comwrap - belebt Ihr Geschäft!

View haha1314.com Pagerank   Alexa rank for haha1314.com 1,654,780   website value of haha1314.com $ 480.00

Sociedad Española de Estudios Clásicos

haha1314.com favicon - estudiosclasicos.org

View haha1314.com Pagerank   Alexa rank for haha1314.com 1,654,780   website value of haha1314.com $ 480.00

Sydney Stone Company

haha1314.com favicon - sydneystone.com.au

View haha1314.com Pagerank   Alexa rank for haha1314.com 1,654,782   website value of haha1314.com $ 480.00